Лъжи, нагли лъжи, статистика и вероятност – Ян Масгрейв

Според мен, преди да обърнем внимание на възраженията срещу еволюционната теория, трябва да се запознаем поне бегло какви хипотези и теории ни предлага науката по въпроса за произхода на живота. Опитах се в този сайт да направя това, но излезе, че едва ли ще успея скоро да представя всичко важно. Същевременно под темите ми, все по-често ми задават ребром въпроса и за да не излезе че избягвам полемиката ще започна този раздел.

И тъй като вече има доста добри публикации по темата – ще започна с превод на статията: “Lies, Damned Lies, Statistics,and Probability of Abiogenesis Calculations” от Ян Масгрейв – Ian Musgrave

Лъжи, нагли лъжи, статистика и вероятност на разчетите за абиогенезата

Въведение

Мине-немине време и някой се изцепи, че “случайно формиране на ензим е почти невъзможно и затова и абиогенезата е невъзможна”. Често прилагат впечатляващите изчисления на астрофизика Фред Хойл (Fred Hoyle) или ни пробутват нещо под названието “Закон на Борел” (Borel), за да докажат, че животът е статистически невъзможен. Тези хора, включително Фред, правят една или няколко от следните грешки:

Проблеми с креационистските “това е толкова невероятно” изчисления:

  1. Те изчисляват вероятността за възникване на “съвременен” белтък, или даже на цяла бактерия с всички “съвременни” белтъци в резултат на случайност. Това теорията за абиогенезата не твърди.
  2. Те допускат, че има точно определен брой белтъци, с фиксирани последователности за всеки белтък, за абсолютно необходими за живота
  3. Те изчисляват вероятността от последователни опити вместо едновременни, успоредни опити.
  4. Те не разбират, какво се има предвид под изчисления на вероятността.
  5. Те сериозно недооценяват количеството действащи ензими/рибозими намиращи се в случайна последователност.

Ще се опитам да ви покажа тези разнообразни грешки и да ви докажа, защо не е възможно да се направи каквото и било разумно изчисление на “вероятността за абиогенеза“.

Доисторическата протоплазмена капка

Според изчисленията, вероятността за случайно възникване на белтък с дължина от 300 аминокиселини (да кажем ензим като carboxypeptidase) е равна на (1/20)^300 или 1 шанс от 2,04*10^390, което е удивително и умопомрачително невероятно. После, това се задълбочава от допълнителни вероятности за възникването на около 400 подобни ензими докато резултатът не стане толкова огромен, че просто само мисълта за такова число може да накара мозъкът ви да изтече през ушите. Това създава впечатлението, че формирането даже на най-малкия организъм е абсолютно невъзможно. Но все пак, това е съвършено неправилно.

 

Първо, формирането на биологични полимери от мономери става по законите на химията и биохимията и тези закони определено не са случайни.

Второ, изначалната предпоставка е неправилна, защото в съвременната теория на абиогенезата първите “живи обекти” са били много по-прости, даже не протобактерии или препротобактерии (това, което Опарин нарича протобионти [8] и Воуз (Woese) нарича протогеноми [4]), а една или няколко прости дълги молекули, не повече от 30-40 субединици. Тези прости молекули бавно се развивали отначало в по-организирани самовъзпроизводителни системи, а след това – в прости организми [2, 5, 10, 15, 28].

Илюстрация, сравняваща хипотетичен протобионт със съвременна бактерия е приложена вдясно.

Схемата е от оригиналната статия

 

Първият “жив обект” може да е бил една самовъзпроизвеждаща се молекула подобна на “самовъзпроизвеждащ се” пептид от групата Гадири (Ghadiri) [7, 17], или самовъзпроизвеждащ се хексануклеотид [10], или полимераза на РНК, която се самокопира [12].


Схемата е от оригиналната статия

Още една гледна точка за това, че първите саморепликатори (самовъзпроизводители) са били групи катализатори, или белтъчни ензими, или рибозими на РНК, които регенерирали себe като каталитичен цикъл [3, 5, 15, 26, 28]. За пример може да служи Sun Y, самовъзпроизвеждаща се от три субединици [24].


play pause
Тези каталитични цикли могат да са ограничени в малък водоем или лагуна или да е каталитичен комплекс, адсорбиран или в глина или с липидни вещества в глина. Ако вземем под внимание, че съществуват много каталитични последователности в група от случайни пептиди или полинуклеотиди (вижте долу), вероятно е, че може да се образува малък каталитичен комплекс.

Teзи два модела не са взаимоизключващи се. Пептидите на Гадири може да мутират и да образуват каталитичен цикъл [9].

Независимо от това били ли са първите саморепликатори единични молекули или комлекси от малки молекули, този модел нямат нищо общо с Хойловия “тайфун на бунище, произвеждащ Боинг 747″. За да подчертая още веднъж мисълта си ще приведа тук просто сравнение на теорията, която критикуват крeационистите и теорията за абиогенезата.

Обърнете внимание, че реалната теория за абиогенезата се състои от няколко малки стъпки. Всъщност съм изпуснал някои стъпки (особено между хиперцикъла и протобионта) за простота. Всяка стъпка е свързана с нарастване на организацията и сложността, а химическите компоненти се движат под “покрива на организма” постепенно, а не го правят с една голяма крачка.

Откъде креационистите са взели представата, че съвременните организми са се сформирали спонтанно, не е много ясно. Първата съвременна формулировка за абиогенезата, хипотезата на Опарина/Холдейн направена през 20-те, започва с прости протеини/протеиноиди бавно развиващи се в клетки. Даже идеите блуждаещи през в 1850-те не били теории за “спонтанност”. Най-близкото, което мога да намеря са оригиналните идеи на Ламарк през 1803! [8]


Схемата е от оригиналната статия

 

Ако вземем под внимание, че креационистите критикуват теория, която е остаряла с 150 години и към която не се подкрепя от нито един съвременен еволюционист биолог, защо трябва да продължаваме? Защото в техните погрешни “опровержения” се проявяват някои фундаментални проблеми със статистиката и биохимията.

Митът за “последователността на живота”

Още едно твърдение, което може често да се чуе, това е че съществува “последователност на живота” от 400 белтъка и аминокиселиниотни и последователностите на тези белтъци не могат да бъдат изменени, ако искаме организмите да останат живи.

Обаче, това са глупости. Изглежда, че историята с 400-те белтъци е тръгнала от кода на гена на белтъка на бактерията Mycobacterium genetalium, която притежава най-малкия генетичен набор сред всички известни сега организми [20]. Всъщност, при по-внимателен преглед се оказва, че този генетичен набор може да бъде намален до 256 белтъка [20]. Отново обърнете внимание, че това е съвременен организъм. Първият протобионт/протогеном би бил още по-малък [4], с предшественици, които биха представлявали още по-прости химически системи [3, 10, 11, 15].

Що се отнася до твърденията, че последователността на белтъците не може да бъде изменена, това е отново безсмислица. В много белтъци съществуват области, където почти всяка аминокиселина може да бъде заменена и други области, където консервативната замяна (заредените аминокиселини могат да бъдат заменени с други заредени аминокиселини, неутралните – с други неутрални аминокиселини и хидрофобните аминокиселини с други хидрофобни аминокиселини) може да бъде направена. Някои функционално еквивалентни молекули могат да се различават от своите аминокиселини с 30-50%. Фактически е възможно да се заменят не еднакви по своята структура белтъци на бактерии с белтъци на дрожди и белтъци на червей с белтъци на човек и при това организмите ще продължат да живеят, все едно че нищо не е било.

“Последователността на живота” е мит.

Подхвърляне на монета за начинаещи и макромолекулярно сглобяване

Все пак нека да поиграем на играта на креационистите и да погледнем на формирането на пептида по пътя на случайно добавяне на аминокиселини. Естествено, пептидите не са възникнали на ранната Земя по този начин, но това ще е поучително упражнение.

За пример, ще използвам споменатия по-рано, самовъзпроизвеждащ се пептид на групата на Гадири [7]. Бих могъл да избера други примери: самовъзпроизвеждащия се хексануклеотид (hexanucleotide) [10], саморепликатора Sun Y [24] или полимеразата на РНК, описана от Екланд (Eckland) и колектив [12], но за историческата последователност с креационистките твърдения малкия пептид е идеален. Този пептид с дължина от 32 аминокиселини с последователност RMKQLEEKVYELLSKVACLEYEVARLKKVGE, се проявява също и като ензим, пептидовата лигаза (ligase), която копира сама себе си от две субединици с дължина от 16 аминокиселини. Той също и по размер и по състав идеално подхожда за възникване по пътя на абиотичен пептидов синтез. Този факт, че той предстравлява и саморепликатор, придава на този пример допълнителна ироничност.

Вероятността за възникване на такъв пептид по пътя на последователни случайни опити е равна на (1/20)^32 или 1 шанс от 4,29*10^40. Това е с много пъти по-вероятно, от 1 шанс от 2,04*10^390 от обичайния креационистки сценарий на “случайно възникноване на carboxypeptidase”, но все пак още е много малко вероятно.

Обаче, съществува друга страна на оценката на вероятностите и тя се свежда до това, че мнозина от нас не разбират добре статистиката. Когато ни казват, че вероятността да се случи едно събитие е само един шанс от милион, мнозина от нас мислят, че трябва да предприемем милион опити, преди да се случи споменатото събитие, но това не е вярно.

Следният експеримент можете да направите и сами: вземете монета, подхвърлете я четири пъти, запишете резултатите и повторете всичко отначало. Колко пъти, мислите, ще ви се наложи да повторите тази процедура докато не ви се паднат 4 пъти тура подред?

Вероятността да ви се паднат 4 пъти тура по ред е равна на (1/2)^4 или 1 шанс от 16. Значи ли това, че ще ни се наложи да направим 16 опита, за да ни се паднат 4 тура (ТТТТ)? Не, в последователни експерименти аз направих 11, 10, 6, 16, 1, 5, и 3 опита, преди да ми се падне ТТТТ. Числа като 1 от 16 (или 1 от милион или 1 от 10^40) ни дават вероятността на събитието в отделно взет опит, но нищо не ни говори за това, къде в последователността на опитите това събитие ще стане. Вие можете да хвърлите ТТТТ ощв в първия си опит (случвало ми се е). Даже при един шанс от 4,29*10^40, саморепликаторът може да се появи много рано. Но това още не е всичко.

1 шанс от 4,29*10^40 е все едно ужасно, умопомрачително малко вероятно, такова число е трудно да се “смели”. Даже при по-горе изнесения аргумент (че може да се падне на първия опит), мнозина ще кажат: “в крайна сметка, все едно, за това ще трябва повече време, отколкото е възрастта на Земята, за да се създаде този репликатор със случайни методи”. Не съвсем. В предишните примери ние разглеждахме последователни опити, като че ли само един белтък/ДНК/прото-репликатор се е заел да прави всеки опит. Всъшност, милиарди едновременни опити може би са ставали с милиарди изграждащи молекули взаимодействащи си в океана или на хиляди километра брегова линия, която е предоставяла каталитична повърхност или шаблони [2, 15].

Нека се върнем към нашия пример с монетите. Да предположим, че подхвърлянето на четири монети ще ни отнеме една минута, а за да се хвърли ТТТТ средно ще трябват 8 минути. Сега доведете 16 приятели, всеки със своята монета, за да хвърлят монетата едновременно 4 пъти. Средното време, за да се хвърли ТТТТ е вече станало равно на една минута. Сега опитайте да хвърлите 6 пъти тура подред, вероятността за това е (1/2)^6 или 1 от 64. Средно ще ви отнеме половин час, но идете и вербувайте 64 човека и ще можете да достигнете желания резултат за една минута. Ако ви се прииска да хвърлите последователност с шанс едно към милиард, то наемете населението на Китай, за да подхвърлят за вас монети и ще хвърлите вашата комбинация за броени минути.

Следователно, ако на нашата предбиологична Земя едновременно са расли милиарди пептиди, то времето необходимо за създаване на репликатора същественно ще намалее.

Добре, вие отново гледате това число, 1 шанс от 4,29*10^40, това е голямо число и милиард молекули за начало са също много молекули. Ще можем ли да намерим достатъчно молекули, за да може случайно да се сглоби нашия пръв възпроизводител за по-малко от половин милиард години?

Да. Един килограм аминокиселини аргинин съдържит 2,85*10^24 молекули (това е доста повече от милиард милиарда). Тон аргинин съдържа 2,85*10^27 молекули. Ако вземете камион, натоварен с аминокиселини и изсипете товара му в езеро среден размер, то ще имате достатъчно молекули, за да създадете нашия възпроизводител за няколко десетки години, отчитайки, че белтъците с дължина от 55 аминокиселини се създават за една, две седмици [14, 16].

Как това се относя към предбиологичната Земя? Океанът на ранната Земя, най-вероятно, е имал обем 1*10^24 литра. Ако приемем концентрацията на аминокиселините за 1*10^-6 М (супа със средна гъстота, виж Чиба (Chyba) и Саган (Sagan) 1992 [23]), тогава ще имаме приблизително 1*10^50 потенциални стартови вериги. При това, прилично количество ефективни пептидни лигази (примерно 1*10^31) може би ще бъде произведено за по-малко от година, да не говорим за милион години. Синтезът на примитивен саморепликатор може да стане относително бързо даже при вероятност от 1 от 4,29*10^40 (и не забравяйте, че репликатора може да бъде синтезиран в най-първия опит).

Да допуснем, че последователността може да бъде синтезирана за седмица [14, 16]. Тогава лигазата на Гадири може също да бъде синтезирана за седмица и всяка последователност на цитохрома С (cytochrome C) за срок малко повече от един милион години.

Макар че използвах лигазата на Гадири за пример, както вече споменах, бих могъл да направя същите изчисления за саморепликатора Sun Y или за полимеразата на РНК на Екленд. Оставям тези упражнения на читателя, но главното заключение (те могат да се появят достатъчно бързо) ще бъде такова за тези олигонуклеотиди (oligonucleotides).

Пространства на търсене или колко игли има в купа сено

По този начин продемонстрирах, че създаването на отделно взет неголям ензим не е така умопомрачително сложно, както креационистите (и Фред Хойл) се опитват да ни убедят. Някакво неразбиране става защото, на хората им се струва, че множеството ензими/рибозими, да не говорим вече за рибозимни полимерази на РНК или всяка форма на саморепликатор, представляват много малко вероятни конфигурации и че шанса за формирането даже на един ензим/рибозим, да не говорим вече за няколко, от случайните аминокиселини/нуклеотиди са много малки.

Обаче, анализите проведени от Екланд показват, че в пространството от 220-нуклетидни РНК последователности, впечатляващите 2,5*10^112 последователности са ефективни лигази [12]. Съвсем не е лошо за вещество, което по-рано се смяташе само за структурно. Да се завърнем в нашия примитивен океан с обем от 1*10^24 литра и предполагаема концентрация на нуклеотиди равна на 1*10^-7 М [23], ще получим примерно 1*10^49 потенциални нуклеотидни вериги и тогава съществено количество от ефективни лигази на РНК (около 1*10^34) може би ще получим в течение на година, да не говорим вече за милиони години. Потенциалното количество полимераза на РНК е също високо. Около 1 на всяка от 10^20 последователности ще бъде полимераза на РНК [12]. Подобни разчети се отнасят също и за рибозомната ацил трансфераза (acyl transferases) (около 1 на всяка от 10^15 последователности), и за синтеза на рибозимните нуклеотиди [1, 6, 13].

Също така, от 1*10^130 възможни 100-компонентни белтъци, 3,8*10^61 представляват цитохром С (cytochrome C)! [29] Съществуват множество функционални ензими в пептидно/нуклеотидното пространство на търсене, затова изглежда възможно, че работещите комплекси ензими напълно са могли да се “сготвят” в предбиологичната супа на ранната Земя.

По този начин, даже при по-реалистични (макар и умопомрачителни) цифри, случайното сглобяване на аминокиселини в “жизнени” системи (да вземем белтъчни ензими, основани на хиперцикли [10], системи от света на РНК [18], или съсъществуващи рибозимно-белтъчни ензими РНК [11, 25]) изглежда съвършено реално, даже с песимистичните цифри за концентрацията на изходния мономер [23] и времето за синтез.

Заключения

Даже самата предпоставка на креационистките изчисления на вероятността е неправилна, тъй като се целят в неправилна теория. Освен това, този аргумент често потъва в статистически и биологични грешки.

Днес, тъй като не знаем, каква е вероятността за живот, практически е невъзможно да му се припишат каквито и да било смислени вероятни стъпки за възникването му, с изключение първите две (мономери в полимери р=1.0, формиране на каталитични полимери р=1.0). Вероятността за преход от възпроизвеждащи се полимери в хиперцикли е равна вероятно на 1.0, при условие, че е прав Кауфман (Kauffman) за каталитичното затваряне и моделите за фазови преходи. Но за подтвърждение на това е нужна истинска химия и по-подробно моделиране. За преход от хиперцикъл в протобионт вероятността зависи от теоретичните концепции, които все още се намират в стадий на разработка и засега са неизвестни.

И накрая, възможността за възникване на живот зависи от химията и биохимията, които все още развиваме, а не от подхвърляне на монети.

Пояснения и термини:

Законът на Борел“, както се цитира от креционистите твърди, че има конкретен порядък вероятност, по-ниско от който се смята, че такова събитие е “по същество невъзможно”. Емил Борел представя логически примери, които всеки може да използва, за да оцени минималната вероятност, под която събития от конкретен тип могат да се считат за незначителни. Важно е да се подчертае, че са приложими за специфични физически проблеми, не като универсален закон.

Абиогенеза:
възникване на живо от неживо, т. е. изходната хипотеза на съвременната теория за произхода на живота.

Ацил трансфераза (Acyl transferase): Ензим (фермент) или рибозим, който синтезират пептиди.

Лигаза (Ligase): Ензим (фермент) или рибозим, който добавя мономер към полимер или съединява къси полимери.

Мономер: Всяка субединица (подединица) полимер. Аминокиселината е мономер на пептид или белтък, нуклеотидът е мономер нa олигонуклеотид или полинуклеотид.

Нуклеотид: Аденин, Гуанин, Цитозин и Урацил. Това са мономери от които се състоят олиго- или полинуклеотиди такива като РНК.

Олигонуклеотид: Къс полимер, състоящ се от нуклеотидни субединици.

Полимераза: Ензим (фермент) или рибозим, създаващ полимер от мономери. Например, полимеразата на РНК произвежда РНК от отделни нуклеотиди.

Рибозим: Биологичен катализатор, произведен от РНК.

Саморепликатор (Самовъзпроизводител):
Молекула, която може да създава идентични или почти идентични копия на самата себе си от по-малки подединици. Известни са ни най-малко четири саморепликатора.

Използвани източници

[1] Unrau PJ, and Bartel DP, RNA-catalysed nucleotide synthesis. Nature, 395: 260-3, 1998

[2] Orgel LE, Polymerization on the rocks: theoretical introduction. Orig Life Evol Biosph, 28: 227-34, 1998

[3] Otsuka J and Nozawa Y. Self-reproducing system can behave as Maxwell’s demon: theoretical illustration under prebiotic conditions. J Theor Biol, 194, 205-221, 1998

[4] Woese C, The universal ancestor. Proc Natl Acad Sci USA, 95: 6854-6859.

[5] Varetto L, Studying artificial life with a molecular automaton. J Theor Biol, 193: 257-85, 1998

[6] Wiegand TW, Janssen RC, and Eaton BE, Selection of RNA amide synthases. Chem Biol, 4: 675-83, 1997

[7] Severin K, Lee DH, Kennan AJ, and Ghadiri MR, A synthetic peptide ligase. Nature, 389: 706-9, 1997

[8] Ruse M, The origin of life, philosophical perspectives. J Theor Biol, 187: 473-482, 1997

[9] Lee DH, Severin K, Yokobayashi Y, and Ghadiri MR, Emergence of symbiosis in peptide self-replication through a hypercyclic network. Nature, 390: 591-4, 1997

[10] Lee DH, Severin K, and Ghadri MR. Autocatalytic networks: the transition from molecular self-replication to molecular ecosystems. Curr Opinion Chem Biol, 1, 491-496, 1997

[11] Di Giulio M, On the RNA world: evidence in favor of an early ribonucleopeptide world. J Mol Evol, 45: 571-8, 1997

[12] Ekland EH, and Bartel DP, RNA-catalysed RNA polymerization using nucleoside triphosphates. Nature, 383: 192, 1996

[13] Lohse PA, and Szostak JW, Ribozyme-catalysed amino-acid transfer reactions. Nature, 381: 442-4, 1996

[14] Ferris JP, Hill AR Jr, Liu R, and Orgel LE, Synthesis of long prebiotic oligomers on mineral surfaces [see comments]. Nature, 381: 59-61, 1996

[15] Lazcano A, and Miller SL, The origin and early evolution of life: prebiotic chemistry, the pre- RNA world, and time. Cell, 85: 793-8, 1996

[16] Ertem G, and Ferris JP, Synthesis of RNA oligomers on heterogeneous templates. Nature, 379: 238-40, 1996

[17] Lee DH, Granja JR, Martinez JA, Severin K, and Ghadri MR, A self-replicating peptide. Nature, 382: 525-8, 1996

[18] Joyce GF, Building the RNA world. Ribozymes. Curr Biol, 6: 965-7, 1996

[19] Ishizaka M, Ohshima Y, and Tani T, Isolation of active ribozymes from an RNA pool of random sequences using an anchored substrate RNA. Biochem Biophys Res Commun, 214: 403-9, 1995

[20] Mushegian AR and Koonin, EV, A minimal gene set for cellular life derived by comparison of complete bacterial genomes. Proc. Natl. Acad. Sci. USA, 93: 10268-10273.

[21] Ekland EH, Szostak JW, and Bartel DP, Structurally complex and highly active RNA ligases derived from random RNA sequences. Science, 269: 364-70, 1995

[22] Breaker RR, and Joyce GF, Emergence of a replicating species from an in vitro RNA evolution reaction.Proc Natl Acad Sci U S A, 91: 6093-7, 1994

[23] Chyba C and Sagan C, Endogenous production, exogenous delivery and impact-shock synthesis of organic molecules: an inventory for the origins of life. Nature, 355: 125-32., 1992

[24] Doudna JA, Couture S, and Szostak JW, A multisubunit ribozyme that is a catalyst of and template for complementary strand RNA synthesis. Science, 251: 1605-8, 1991

[25] Lahav N, Prebiotic co-evolution of self-replication and translation or RNA world? J Theor Biol, 151: 531-9, 1991

[26] Stadler PF, Dynamics of autocatalytic reaction networks. IV: Inhomogeneous replicator networks. Biosystems, 26: 1-19, 1991

[27] Eigen M, Gardiner W, Schuster P, and Winkler-Oswatitsch R, The origin of genetic information. Sci Am, 244: 88-92, 96, et passim, 1981

[28] Eigen M, and Schuster P, The hypercycle. A principle of natural self-organization. Springer-Verlag, isbn 3-540-09293, 1979

[29] Yockey HP, On the information content of cytochrome c. J Theor Biol, 67: 345-76, 1977

Използвани книги

Statistics at Square One, T.D.V. Swinscow, 8th Edition Paperback, Published by Amer College of Physicians, 1983, ISBN: 0727901753

Evolution from Space, F Hoyle and Wickramasinghe, JM Dent and sons, London, 1981

Vital Dust: Life As a Cosmic Imperative, by Christian De Duve, Basic Books 1995, ISBN: 0465090451

The Major Transitions in Evolution, Maynard Smith J & Szathmary E, 1995, WH Freeman, ISBN: 0716745259

The Origins of Order: Self Organization and Selection in Evolution. By Stuart Kauffman, S. A. (1993) Oxford University Press, NY, ISBN: 0195079515.

At Home in the Universe. By Stuart Kauffman, 1995) Oxford University Press, NY.

Линкове

Прочети още ...

Неинтелигентният дизайн

14 отговора към “Лъжи, нагли лъжи, статистика и вероятност – Ян Масгрейв”

  1. Теодор Гочев казва:

    Науката не отхвърля Божествения произход на Вселената, а я потвърждава. В желанието си да се задълбочите в науката, не успявате да забележите истината.

    Законите и закономерностите в науката, еволюцията на видовете, човекът и неговият съзнателен и творчески живот и всичко останало е потвърждение за Великото Сътворение на нашият Творец, в който ние заемаме главна роля.

    Възприемането на библейските текстове дословно показва ниска степен на интелигентност.

    • Vanya казва:

      Къде и коя наука? В кое научно списание? Факти? Аргументи? Числа? Тук говорим на този език.
      Смятате ли, че света е създаден за 6 дена? Че когато чуете гръмотевица, свети Илия минава с колесницата си? Слънцето се върти около Земята? Както наскоро Ватиканът призна, че Галилей е бил прав, след стотина – двеста години вероятно ще признае еволюцията. Такава е тенденцията.
      Този сайт е за знания, които могат да се проверят. Религията и науката са разделени вече от векове. И ако науката се развива, проверявайки в експерименти правотата или грешките си, религията отстоява догми и стари легенди. Просто не й е работа на религията да дава знания по математика, физика, биология – нито свещениците имат знания и подготовка, нито в манастирите има лаборатории, нали?
      Не казвам, че религията няма място в нашия живот, но идете при бедните, нещастните и болни хора и им дайте утеха, а не се хвърляйте в битки, които не са ваши.
      Уважавам вярата Ви, но заядливия Ви тон не говори за християнско отношение, поработете върху Добротата и Смирението, но за това ще Ви помогнат други сайтове. Успех :)

      • badr казва:

        Ватиканът бил признал.Ето това се нарича спекулация.
        Признал, непризнал Ватикана – слънцето се върти около земята.Това не е въпрос на коментар, а на наблюдение, на емпиричен опит.
        Ако ще говорим за наука, защо се пренебрегва именно резултата от наблюдението, когато в науката резултат от наблюдение не се оспорва.

  2. AZ казва:

    Като изключим някои дребни грешки в текста, статията е добра. Сайтът също бива. Смятам, че в българското интернет пространство трябва да има повече сайтове на подобни теми.

  3. Густав Б. казва:

    Привет :)
    Съгласен съм, че науката би трябвало да се развива, проверявайки в експерименти правотата или грешките си. Иначе набързо ще се превърне в доктринерска догма, не че не й се случва между проверките и експериментите.
    А бръсначът на Окам би трябвало да бръсне наред, струва ми се? Хайде да проверим.
    Да си представим, че попаднем на устройство, което моделира въртенето на Земята около себе си за 24 часа, 60 минути и 60 секунди, макар и с известна неточност. На него има надпис, да речем, “Омега”. Има сложно устройство.
    Ние предполагаме, че:
    - е произведено с цел някой да си измерва времето на точно тази планета от швейцарската фирма “Омега”, нарича се “часовник” и според някои древни легенди и папируси с техническа документация, е проект на някой си инж. Густав Бох или Бьог, че подписът не се чете ясно;
    - става дума за съвпадение, всъщност устройството нищо не моделира;
    - самообразувало се е в резултат от стохастична конкуренция с подобни нищо немоделиращи устройства, на които пише “Совсоюзмаш”;
    - всички тези нищо немоделиращи природни феномени са случайно конфигурирани в море от протообразувания, наричани “зъбни колелца”, което статистически е напълно нормално, като се има предвид, че морето е на милиони години и в него има милиарди зъбни колелца, които пък са се образували в резултат от вулканични изригвания.

    Ето и линкче с научно-популярно филмче за ориентация. Никаква пропаганда на съмнителни идеи, просто група научно чистоплътни светила на генетиката тези дни се събрали да обсъдят някои новооткрити надписи по капака на часовника.

    http://www.youtube.com/watch?v=n5g5Hhv36UE&feature=related

    • AZ казва:

      Интересно, само ще кажа, че условието на тази задача не е коректно зададено. Достатъчен е фактът, че устройството е само едно и не може да се репликира и развива само.

      • Vanya казва:

        Това, че може да се репликира и развива е факт! Става бавно наистина и за седмица-две нищо няма да забележите, но все пак има примери. Прочете За мутациите и сложността . Какво разбирате под “само”? Кой го развива тогава? “Дизайнерът”?

  4. AZ казва:

    Първо, извинявам се за огромното закъснение с отговора. Бях зает. Искам да кажа, че задачата коментара над моя не е коректна. Моме, чети внимателно всичко, та да не стават конфузи. Прочети коментара над моя и ще разбереш кое не може да се развива само. Аман от неразбрали.

  5. AZ казва:

    Понеже съм писал по-горния си коментар на неособено трезва глава-ето още разяснения(като за слабоумни).
    Коментарът ми, на който ти отговаряш, е 4-ти по ред (някой, който се е писал Густав нещо си). Броиш коментарите от по-стар към по-нов. Сега се надявам да ти е по-ясно.

  6. Vanya казва:

    Нямаше нужда да стигате до ниво “слабоумни”. Разбрах Ви още от предишния ви коментар.
    Нека да пишем само на трезва глава, ясно и точно, без обиди, само с факти, аргументи и логика.

  7. Gabo Todorov казва:

    Много ми хареса примера с монетата – доказателство за естеството на случайностите. Само че фактора интелект движещ експеримента е причината за манипулацията на монетата, както и резултата е следствие от причината. Как можем да направим подобен експеримент без намеса на интелект – това ще е забавен експеримент. Имам предвид, че интелектът – живота е следствие от самата причина. Тоест, проявата на интелект (като живот, или съзнание) е възможна, само защото той съществува на първо място. Който в последствие се проявява във всички нива на фракталната вселена. Всъщност ние като съзнателно същества не сме изключение и не сме нещо специално, а просто една от многото прояви на първичния интелект., който е вплетен в самата тъкан на материята. Квантовата механика е един много солиден пример на тази проява. Особено квантовото заплитане и изчислителната мощност на паралелните вероятности, която крие. Вселената е интелигентна, а ние като един резултат в нея притежаваме нейните свойства.

  8. Just desire to say your article is as astounding.

    The clarity to your publish is just cool and that i can think you’re a professional in this subject.

    Fine with your permission let me to seize your feed to stay
    up to date with drawing close post. Thank you one million and please keep up the
    enjoyable work.

    My homepage intoxicated driving lawyer Burbank

  9. Марги - фанатичка казва:

    “Тези прости молекули бавно се развивали отначало в по-организирани самовъзпроизводителни системи, а след това – в прости организми “- кой ти каза че така е станало? Спекулативни твърдения без грам доказателство!
    “Ензим (фермент) или рибозим, създаващ полимер”-това някаква даденост ли е, или и той е възникнал случайно и постепенно!
    “нарастване на организацията и сложността,..”- Къде в природата, освен във вече живия организъм, има такова явление?
    “Първата съвременна формулировка за абиогенезата, хипотезата на Опарина/Холдейн направена през 20-те, започва с прости протеини/протеиноиди бавно развиващи се в клетки.”- Лъжи, нагли лъжи,никога не са се развивали живи клетки от тези опити!
    “Всъшност, милиарди едновременни опити може би са ставали с милиарди изграждащи молекули взаимодействащи си в океана …”-може би, може би…Ь-ъ защо днес науката не ще да синтезира ЖИВИ клетки?
    Цялата тази наукообразна попара, която ни сипват в паничката,е отрова за безсмъртната ни душа!За да не размишляваме и да не повярваме, че Бог СЪТВОРИ света!

  10. fraxinus казва:

    Тук с произходът на живота трябва да признаем ,че Бръсначът на Окам е в полза интелигентен дизайн. При това еволюцията ,която може да се докаже няма да докаже спонтанно възникване. Разликата между амебата и човек е минимална,сравнена с разликата между най-простият прокариот и неживото. Който се е занимавал бегло с цитология знае колко е сложена структурата на клетката ,колко сложен метаболизмът и биохимията в цитоплазмата. Има и прости структури като вирусите ,но те нямат собствена обмяна ,а ползват тази на гостоприемника ,какъвто е нямало в началото.
    Всички процеси са точно координирани и в синхрон ,органелите са точно такива ,каквито трябва. С малка промяна и всичко пропада.Тъй че сравнението със самолет и торнадо дори е меко -хората правят самолети от суровини и минерали ,но не са успели да създадат изцяло синтетична клетка /не просто да поставят хромозома в жива клетка/ Вероятно някой ден и това ще стане ,но все-пак е много по-сложно. Та най простото обяснение е ,че Господ е направил така ,че да има живот.

Вашият коментар

Or

Вашият email адрес няма да бъде публикуван Задължителните полета са отбелязани с *

*


Можете да използвате тези HTML тагове и атрибути: <a href="" title=""> <abbr title=""> <acronym title=""> <b> <blockquote cite=""> <cite> <code> <del datetime=""> <em> <i> <q cite=""> <strike> <strong>